Protein Info for PGA1_c14100 in Phaeobacter inhibens DSM 17395

Annotation: 3-dehydroquinate synthase AroB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01357: 3-dehydroquinate synthase
  • amino acids 19 to 366 (348 residues), 356.3 bits, E=8.9e-111
• PF00465: Fe-ADH
  • amino acids 21 to 190 (170 residues), 32.7 bits, E=5.8e-12
• PF13685: Fe-ADH_2
  • amino acids 23 to 195 (173 residues), 42.5 bits, E=1e-14
• PF01761: DHQ_synthase
  • amino acids 75 to 337 (263 residues), 319.6 bits, E=2e-99

Best Hits

Swiss-Prot: 86% identical to AROB_RUEST: 3-dehydroquinate synthase (aroB) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 86% identity to sit:TM1040_1432)

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• 3-dehydroquinate biosynthesis I (2/2 steps found)
• superpathway of chorismate metabolism (36/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

See I7ELK4 at UniProt or InterPro

Protein Sequence (375 amino acids)

>PGA1_c14100 3-dehydroquinate synthase AroB (Phaeobacter inhibens DSM 17395)
MEQAMLERSVHVALGERAYDVVIGPDLLADAGARLAPMLRRPKVAVLTDETVAAHHLEGL
RAGLASAGIEMDALALPPGESTKAWPQFSRAVEWLLEQKVERGDIVIAFGGGVIGDLAGF
AAAVLRRGVRFVQIPTSLLAQVDSSVGGKTGINAPQGKNLIGAFHQPSLVLADTALLGTL
TPRDFLAGYGEVVKYGLLGDAEFFEWLEAQGPALAAGDMAARVEAVTRSVQMKADIVVRD
ETEQGDRALLNLGHTFCHALEAATGYGDRLLHGEGVAIGCALAFELSARLGLCSQEDPSR
VRAHLKAMGMKTDLADIPGELPDAEALLALMGQDKKVVDGQLRFILARGIGQAFVTGDVP
QAAVLDVLRDALAQS