Protein Info for Psest_1429 in Pseudomonas stutzeri RCH2

Annotation: Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF00676: E1_dh" amino acids 43 to 321 (279 residues), 248.6 bits, see alignment E=1.1e-77 PF13292: DXP_synthase_N" amino acids 130 to 190 (61 residues), 23.5 bits, see alignment E=4.6e-09

Best Hits

Swiss-Prot: 41% identical to ODPA_PORPU: Pyruvate dehydrogenase E1 component subunit alpha (pdhA) from Porphyra purpurea

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 70% identity to swd:Swoo_2931)

MetaCyc: 42% identical to acetoin:DCPIP oxidoreductase alpha subunit (Syntrophotalea carbinolica DSM 2380)
RXN-9718 [EC: 2.3.1.190]

Predicted SEED Role

"Acetoin dehydrogenase E1 component alpha-subunit (EC 1.2.4.-)" in subsystem Acetoin, butanediol metabolism (EC 1.2.4.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.-, 1.2.4.1

Use Curated BLAST to search for 1.2.4.- or 1.2.4.1 or 2.3.1.190

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGY9 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Psest_1429 Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit (Pseudomonas stutzeri RCH2)
MTQPNNSQRLWMYEQMLTSRYMEESIERIYMEGKTPVFNMAKGPIPGEMHLSNGQEPCAV
GVCAHLEAEDIVTATHRPHHIAVAKGVDLNEMMAEIFGKATGLSGGRGGHMHLFDGRVNF
SCSGIIAEGMGPAVGAALSRQMQGKPGVAVSFIGEGAANQGAFHETLNLAALWKLPVVFV
IEDNAWGISVAKASATCIAQHHVRAAAYGMPGVFVENNDPDGVFRAAGEAIERARAGGGP
TLIEIETYRLAGHFMGDGETYRPEGEKDGLIKKDPIPGYRQRLIDEGVLSEAQAEDIAAR
ARGRIDEAVQFARESPYPRPEEALEKVFV