Protein Info for HP15_1358 in Marinobacter adhaerens HP15

Annotation: formyltetrahydrofolate deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00655: formyltetrahydrofolate deformylase
  • amino acids 1 to 236 (236 residues), 317.6 bits, E=4.4e-99
• PF00551: Formyl_trans_N
  • amino acids 41 to 216 (176 residues), 154.2 bits, E=1.6e-49

Best Hits

Swiss-Prot: 48% identical to PURU_CORS1: Formyltetrahydrofolate deformylase (purU) from Corynebacterium sp. (strain P-1)

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 95% identity to maq:Maqu_1020)

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

• formaldehyde oxidation VII (THF pathway) (4/4 steps found)
• folate transformations I (8/13 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)
• purine nucleobases degradation II (anaerobic) (11/24 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Sequence Analysis Tools

See E4PJD7 at UniProt or InterPro

Protein Sequence (237 amino acids)

>HP15_1358 formyltetrahydrofolate deformylase (Marinobacter adhaerens HP15)
MRHEIKATSIPFGLDQFRAAFEPIAREFNMNWHIADSAQPKKVILMCSKESHCVADLLHR
WHSKEINAEIVAVISNHDDLRRMVEWHEIPYHHVPVSKENKEEAFAHIDELFQKYEADVV
VLARYMQILPGELCEKYSGKVINIHHSFLPSFAGARPYHQAYSRGVKLIGATCHYVTQDL
DEGPIIEQDVIRITHSDSIEDMVRLGKDVEKNVLARGLRSHIEDRVITYENKTVVFD