Protein Info for PGA1_c14060 in Phaeobacter inhibens DSM 17395

Annotation: tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF02899: Phage_int_SAM_1" amino acids 27 to 101 (75 residues), 54.8 bits, see alignment E=9.8e-19 PF00589: Phage_integrase" amino acids 124 to 305 (182 residues), 138.1 bits, see alignment E=2.8e-44

Best Hits

Swiss-Prot: 50% identical to XERD_CAUVC: Tyrosine recombinase XerD (xerD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 79% identity to sil:SPO1632)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E059 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PGA1_c14060 tyrosine recombinase XerD (Phaeobacter inhibens DSM 17395)
MTPPAAQSANAPKDDLQWIATFLDAQAADLGAARNTLLAYGRDLKDVASWLGHKNRAFGS
ATRDDIESYLIACDAEGLARATRARRLSAIKQIYRFAFDEGWRSDNPAIQIKGPGRQKAL
PKTLEVIEVDRLLDAARQSGRNLSDRLRNTCMMELLYATGMRVSELVGLPVAAARGDPRM
LLVLGKGGKERMVPLSPPARDALAAWLTTRDAAEEAAVAKGAAPSRFLFPSRGKSGHLTR
HRFYLLIKEFAVAGGLPPEAVSPHTLRHAFATHLLTNGADLRAIQALLGHADIATTEIYT
HVLDARLSELVLEHHPLARKDTGSDQPLQQDDDGPTE