Protein Info for Psest_1421 in Pseudomonas stutzeri RCH2

Annotation: Glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF02798: GST_N" amino acids 1 to 73 (73 residues), 46.6 bits, see alignment E=1.1e-15 PF13417: GST_N_3" amino acids 3 to 78 (76 residues), 39.5 bits, see alignment E=1.7e-13 PF13409: GST_N_2" amino acids 9 to 73 (65 residues), 39.2 bits, see alignment E=2.7e-13 PF00043: GST_C" amino acids 122 to 189 (68 residues), 35.9 bits, see alignment E=2.1e-12 PF13410: GST_C_2" amino acids 123 to 184 (62 residues), 29.2 bits, see alignment E=2.4e-10

Best Hits

Swiss-Prot: 45% identical to GSTA_RHILE: Protein GstA (gstA) from Rhizobium leguminosarum

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 72% identity to psp:PSPPH_1739)

MetaCyc: 39% identical to glutathione-S-transferase NdmE (Pseudomonas putida CBB5)
RXN-11518 [EC: 1.14.13.128]

Predicted SEED Role

"Glutathione S-transferase, unnamed subgroup (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 1.14.13.128 or 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKS5 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Psest_1421 Glutathione S-transferase (Pseudomonas stutzeri RCH2)
MKLYDLGPSGNCYKVRLFAALANIDLELVAVDFANGAHKKPPLSELNPLEQLPILDDGGH
IVRDSQAILVYLAGAYGGLAWWPDNPRGQAEIVQWLSFTANEIQQSLNAARLVQKFGYPL
DKAAALAKAPAVLKLLDDHLQRHDWLAIDRPTIADCAVYPYVVLAPEGDVDLTPYRHVAR
WMERLEALPGYLPKP