Protein Info for Psest_1409 in Pseudomonas stutzeri RCH2

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00106: adh_short" amino acids 12 to 193 (182 residues), 57 bits, see alignment E=2.9e-19 PF01370: Epimerase" amino acids 12 to 79 (68 residues), 21.6 bits, see alignment E=2e-08 PF13561: adh_short_C2" amino acids 47 to 194 (148 residues), 41.9 bits, see alignment E=1.4e-14

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_2883)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.140

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKQ9 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Psest_1409 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Pseudomonas stutzeri RCH2)
MPLDSFPEGFRALVIGASGGIGAALVDALRSDPRCASVIALSRSSEPALDLTDPASIEQA
AASVAGQGPFHLIVNAAGVLHGADFMPEKRLADLNQAQLLATFQINTFGPAMLLRHFSGL
LDRQRGVFAMLSAKVGSIGDNRLGGWYSYRASKAALNMLIKTASIEVRRSQPNAVLLALH
PGTVNSRLSQPFRGEEIGRPASDAARDLLRVIDGLGPEASGGFYAYSGEELPW