Protein Info for Psest_1407 in Pseudomonas stutzeri RCH2

Annotation: RecA-superfamily ATPases implicated in signal transduction

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 PF06745: ATPase" amino acids 18 to 244 (227 residues), 129 bits, see alignment E=8.8e-41 amino acids 261 to 478 (218 residues), 76.7 bits, see alignment E=8e-25 PF13481: AAA_25" amino acids 261 to 381 (121 residues), 35.5 bits, see alignment E=3.8e-12

Best Hits

KEGG orthology group: K08482, circadian clock protein KaiC (inferred from 88% identity to psa:PST_2885)

Predicted SEED Role

"Circadian clock protein KaiC" in subsystem Cyanobacterial Circadian Clock

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGV6 at UniProt or InterPro

Protein Sequence (508 amino acids)

>Psest_1407 RecA-superfamily ATPases implicated in signal transduction (Pseudomonas stutzeri RCH2)
MTDFTNLSFQPDDEPPRISTGSEGLDDILGGGLDPNRMYLYEGSPGSGKTTIALQFLLEG
VRQGERVLYVTLSETKDELELVAKRHGWSLDGIDVFELVTPETSLDPDLELTVLHPVEME
LSETTQQVFDRVTETNPSRVIFDSLSEMRLLAQSPLRYRRQVLALKHFFTTRNCTVILLD
DQTSEVGDLQLHSISHGVVMLEQVAIDYGAERRRLRVIKMRGIQFRGGYHDFAIRKGGLR
IYPRLIAAEHHSSFSGELASSGNPALDKMLGGGLERGTNALLVGAAGVGKSSLALSYAVA
ACKRGEQVAFFVFDENIATLLARGRALGLPMEPWIEQGLLHLQQVDPAELSPGEFTAAVR
QSVEVRGAGLVILDSLNGYLHAMPDGRFLILQMHELLSYLGQKGVISIMVLAQHGLVGPM
DTPVDISYLSDAVIMQRYFEHAGVVRRALSVVKKRSGRHENTVREYRLSSAGLEVGPPLS
HFSGILSGTPEYTGDATQLLTDEHDDAH