Protein Info for HP15_1339 in Marinobacter adhaerens HP15

Annotation: cupin 2 conserved barrel domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07883: Cupin_2
  • amino acids 38 to 97 (60 residues), 42.6 bits, E=2e-15

Best Hits

KEGG orthology group: None (inferred from 72% identity to pct:PC1_1138)

Predicted SEED Role

"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)

MetaCyc Pathways

• GDP-mannose biosynthesis (4/4 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• D-mannose degradation I (1/2 steps found)
• D-mannose degradation II (1/2 steps found)
• mannitol degradation II (2/4 steps found)
• mannitol biosynthesis (1/3 steps found)
• 1,5-anhydrofructose degradation (2/5 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (6/14 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.8

Sequence Analysis Tools

See E4PIM8 at UniProt or InterPro

Protein Sequence (121 amino acids)

>HP15_1339 cupin 2 conserved barrel domain protein (Marinobacter adhaerens HP15)
MGYQAINFKNKLGLFDEQWSPKVIAEMNDYQFKVVKIQGEFVWHDHKDTDETFIVLEGSL
RINFRDGHVDLSEGEMYVVQKGVEHKPFAEHEAKVLLIEPRGVVNTGDETGTQTAENDVW
I