Protein Info for Psest_1404 in Pseudomonas stutzeri RCH2

Annotation: Methyltransferase domain.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF01209: Ubie_methyltran" amino acids 18 to 148 (131 residues), 29.7 bits, see alignment E=1.7e-10 PF00891: Methyltransf_2" amino acids 31 to 146 (116 residues), 27.1 bits, see alignment E=1.1e-09 PF13489: Methyltransf_23" amino acids 38 to 152 (115 residues), 27.6 bits, see alignment E=8.9e-10 PF05401: NodS" amino acids 40 to 144 (105 residues), 27.2 bits, see alignment E=1.4e-09 PF13847: Methyltransf_31" amino acids 42 to 148 (107 residues), 30.8 bits, see alignment E=9.2e-11 PF13649: Methyltransf_25" amino acids 44 to 140 (97 residues), 50.8 bits, see alignment E=9.1e-17 PF08242: Methyltransf_12" amino acids 45 to 141 (97 residues), 48.7 bits, see alignment E=4.4e-16 PF08241: Methyltransf_11" amino acids 46 to 144 (99 residues), 49.7 bits, see alignment E=2e-16

Best Hits

KEGG orthology group: None (inferred from 73% identity to pin:Ping_1362)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKP1 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Psest_1404 Methyltransferase domain. (Pseudomonas stutzeri RCH2)
MQPKDHWEKVYSTKAADEVSWFQEHAELSLKLIRDADVPSTASIIDVGGGASTLVDDLLA
NGYRNLTVLDLSAAALATAKTRLGSNAASVRWLEANVIEAALPERSFDVWHDRAVFHFLT
SEEDRHAYVRQVLHAVKPGGLVIVATFAEDGPEKCSGLPVMRYGASELHAEFGEPFLLLG
HEKESHHTPGGIEQKFVYCFCRKLVQ