Protein Info for Psest_1403 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 56 to 74 (19 residues), see Phobius details PF13404: HTH_AsnC-type" amino acids 4 to 45 (42 residues), 60.9 bits, see alignment E=1.3e-20 PF13412: HTH_24" amino acids 4 to 51 (48 residues), 70.3 bits, see alignment E=1.2e-23 PF01037: AsnC_trans_reg" amino acids 68 to 149 (82 residues), 75.8 bits, see alignment E=2.9e-25

Best Hits

Swiss-Prot: 40% identical to LRP_RHIME: Leucine-responsive regulatory protein (lrp) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 70% identity to pbr:PB2503_08274)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKV9 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Psest_1403 Transcriptional regulators (Pseudomonas stutzeri RCH2)
MLEIDRIDRKILRELSDDARQTNLKLAERVGLSPSACLRRVQELERSGVIKGYRAVIDKA
LLGAGFVVYVAVGLSSHTKESLGAFERAIAASPDVVEFHTVTGALEYLLRVEVADIKAYK
LFHTEVLGTLPHVSSITSYIVMDTPKSERG