Protein Info for Psest_1402 in Pseudomonas stutzeri RCH2

Annotation: Putative threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 64 (25 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 140 to 166 (27 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details PF01810: LysE" amino acids 19 to 191 (173 residues), 47.5 bits, see alignment E=7.6e-17

Best Hits

KEGG orthology group: None (inferred from 46% identity to bpa:BPP3820)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGT7 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Psest_1402 Putative threonine efflux protein (Pseudomonas stutzeri RCH2)
MSDLGVLLPFLMFAIVMTGTPGPNNLMVLMSGARVGVLRTMPLVCGIALGIGLQLAIVGS
GLGSAFERIPGFHNALSVVGAAYILWLAWAIANSGPLQMQVDPKPPMGLISGAAFQWINP
KAWALSISVAATYIPPENHFLNLCIAAVILAAISVPCVGVWALGGLTFRRWLGRPRIASA
FNVSMAVILVVATMPAVLNLSI