Protein Info for Psest_1401 in Pseudomonas stutzeri RCH2

Annotation: Isopenicillin N synthase and related dioxygenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF14226: DIOX_N" amino acids 15 to 140 (126 residues), 107.8 bits, see alignment E=5.6e-35 PF03171: 2OG-FeII_Oxy" amino acids 187 to 285 (99 residues), 90 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 46% identical to HXNY_EMENI: 2-oxoglutarate-Fe(II) type oxidoreductase hxnY (hxnY) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

KEGG orthology group: None (inferred from 95% identity to psa:PST_2897)

Predicted SEED Role

"2-Oxobutyrate oxidase, putative" in subsystem Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJJ1 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Psest_1401 Isopenicillin N synthase and related dioxygenases (Pseudomonas stutzeri RCH2)
MNQSLCARHLEAAALPLIDIAGLFSPDLAERTAVAERIGAACREVGFFCVANHGVDPALQ
QAVFEQARAFFSQPEAGKRALDKVFSKANRGYEPLRGQVLEAGAPADLKEGFYIGEELAE
DDPRVLAGRFNHGANQWPTELADFRPTMERYRDAMNALAARLMGAIALSLQLPEEHFAGF
CRDSMSTLRLLHYPPQPTNAAPGEKGCGAHTDFGGLTLLLQDENPGLQVWDRHSKSWIHA
APVPGTYVVNLGDMIARWTNDQYRSTLHRVVNISGRERYSVPFFFSGNPDHLVECLPTCL
APGEAPRYPAVTVEEHHREMYRRTYG