Protein Info for Psest_0136 in Pseudomonas stutzeri RCH2

Annotation: amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 155 to 156 (2 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 116 (107 residues), 74.4 bits, see alignment E=4.4e-25 PF00528: BPD_transp_1" amino acids 30 to 222 (193 residues), 75.7 bits, see alignment E=2e-25

Best Hits

Swiss-Prot: 46% identical to NOCM_AGRFC: Nopaline transport system permease protein NocM (nocM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 98% identity to psa:PST_4106)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHF6 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Psest_0136 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (Pseudomonas stutzeri RCH2)
MTWEIFIKWLPSFIDGAWLTLQLVGVSVIAGLIVAVPLGIARSSRHLAVRALPYGYIFFF
RGTPLLVQLFLVYYGMAQFDVVRQSALWPYLRDPYWCAIITMTLHTAAYIAEIIRGAIQN
VPHGEIEAARALGMSRSQALLHIILPRATRIGLPAYSNEVILMLKASALASTITLLELTG
MARKIAARTYLHEEMFLTAGLIYLLIAFILMQGFKLLERWLRVDACQGR