Protein Info for PGA1_c01380 in Phaeobacter inhibens DSM 17395

Annotation: 50S ribosomal protein L11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01632: ribosomal protein uL11
  • amino acids 3 to 141 (139 residues), 213.7 bits, E=4.7e-68
• PF03946: Ribosomal_L11_N
  • amino acids 9 to 67 (59 residues), 100.8 bits, E=2.8e-33
• PF00298: Ribosomal_L11
  • amino acids 72 to 140 (69 residues), 104.3 bits, E=3.6e-34

Best Hits

Swiss-Prot: 96% identical to RL11_RUEST: 50S ribosomal protein L11 (rplK) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02867, large subunit ribosomal protein L11 (inferred from 96% identity to sit:TM1040_0229)

MetaCyc: 60% identical to 50S ribosomal subunit protein L11 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L11p (L12e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

See I7EIE5 at UniProt or InterPro

Protein Sequence (141 amino acids)

>PGA1_c01380 50S ribosomal protein L11 (Phaeobacter inhibens DSM 17395)
MAKKLVGTMKLQVPAGKANPSPPVGPALGQRGINIMEFCKAFNAKTADMEPGAPCPTVIT
YYQDKSFTMDIKTPPASYYLKKAAKVKSGANNPSRETVGTVSVAQVKEIAEAKMKDLNAN
DIEAAMQIILGSARSMGIEVK