Protein Info for Psest_1391 in Pseudomonas stutzeri RCH2

Annotation: ABC-type uncharacterized transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 14 to 20 (7 residues), see Phobius details amino acids 39 to 40 (2 residues), see Phobius details transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 280 to 312 (33 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 61 to 338 (278 residues), 176.6 bits, see alignment E=2.9e-56

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 99% identity to psa:PST_2908)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJH9 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Psest_1391 ABC-type uncharacterized transport system, permease component (Pseudomonas stutzeri RCH2)
MLLSLQPRGEASRAMLWFSPLLAALLTLLSGALLFALLGHPPLETLKVLLIDPLGDLYGV
SELLVKALPILLCALGLAVVYNARIWNIGAEGQLLIGALAGSALAVNIIDWDSRWALVLT
LLLGTLGGAAWAGLCAWLKTAFNANEILTSIMLNYIALNLLLFAVHGPLKDPEGFNFPES
AMFGDATRLPELIEGLRVHGGFYFALLALVVVWVLLQKSFLGFQIKVLGLDKRAAGFVGF
RDKKLVWIALLISGGLAGLAGVAEVTGPIGQLVPQVSPGYGYAAITVAFLGRLNPIGIVF
ASLLMALLYLGGENAQMAANLPQSITQLFQGMVLFFLLACDVLILYRPRLKLWARKPQLV
SAKEEPAT