Protein Info for HP15_1322 in Marinobacter adhaerens HP15

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR00730: TIGR00730 family protein" amino acids 114 to 283 (170 residues), 107.5 bits, see alignment E=3.3e-35 PF18306: LDcluster4" amino acids 115 to 224 (110 residues), 39.1 bits, see alignment E=5.8e-14 PF03641: Lysine_decarbox" amino acids 152 to 280 (129 residues), 103.7 bits, see alignment E=8.9e-34

Best Hits

KEGG orthology group: K06966, (no description) (inferred from 64% identity to mmt:Metme_1801)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIL1 at UniProt or InterPro

Protein Sequence (297 amino acids)

>HP15_1322 conserved hypothetical protein (Marinobacter adhaerens HP15)
MPWQTPKAAEDDPEALERVQALIASPGYRQADRDVEFLNEEDTRGVRLQIDYLKPELLLK
KHGIEHTIVVFGSTRLHQPEAARRKVAALEEASAGSPENEDLQCRLQVAKAIESKSRYYE
EARRLGRLVAECGEGPEDSRVTMVTGGGPGIMEAANRGAFDVGAKSVGLNITLPHEQFPN
PYITPDLCFRFHYFAMRKLHFLKRAKALVAFPGGYGTLDELFETLTLVQTRTIAPLPIVL
VGESFWRQAVNIDFLVAEGVIDEEDRELFWYAETAEEIWDGIRHWHRASGSPLPNNN