Protein Info for Psest_0135 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized enzymes related to aldose 1-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF01263: Aldose_epim" amino acids 25 to 293 (269 residues), 151.6 bits, see alignment E=1.7e-48

Best Hits

KEGG orthology group: K01792, glucose-6-phosphate 1-epimerase [EC: 5.1.3.15] (inferred from 93% identity to psa:PST_4107)

Predicted SEED Role

"Aldose 1-epimerase"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GDD2 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Psest_0135 Uncharacterized enzymes related to aldose 1-epimerase (Pseudomonas stutzeri RCH2)
MPVDIQRIEMNQLVCWRVRRGEDELLIAEQGAQILSYRQGDAPPIIWLSEEAAFEQGQSV
RGGVPVCWPWFGDLARNPQAVQANYSGEQPAPFHGLVRALPWQLREQRSEGDTAILEFHC
PQALGELPGLPHRVELTLQIRLADELELSLSSRNVGVEAISISQALHSYFAVSDIHQVRV
EGLAGCPYIDTLLDWQQRQQQNGDLAFNGETDRIYLQLPTTLQLIDPAWKRSIRLTTRGS
RSAVLWNPWIDKAKRLSSYADDAWQRMACIETANVLDDVVVLQPGQQHLLGVSITADPAH