Protein Info for PGA1_c13600 in Phaeobacter inhibens DSM 17395

Annotation: ABC-type transport system, involved in lipoprotein release, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 48 (48 residues), see Phobius details transmembrane" amino acids 258 to 282 (25 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 345 to 368 (24 residues), see Phobius details PF12704: MacB_PCD" amino acids 21 to 228 (208 residues), 42.4 bits, see alignment E=1e-14 PF02687: FtsX" amino acids 263 to 372 (110 residues), 46.2 bits, see alignment E=4.5e-16

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 66% identity to rlg:Rleg_2581)

Predicted SEED Role

"ABC-type antimicrobial peptide transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E008 at UniProt or InterPro

Protein Sequence (380 amino acids)

>PGA1_c13600 ABC-type transport system, involved in lipoprotein release, permease component (Phaeobacter inhibens DSM 17395)
MTFLTLARRNAWRKPMRTLLLMFCIAVAFLIYGLTASFLSGTQGSAAANDDVLGVMNKSG
RGQTLPIAHLRRIAALDGVAEVAYMSRLRGFSEVERNVVVANAVAVDDFARINGDSLALT
SDLLAALKQGRDRVLVGRALADAQGWRPGQRIEITSFNIMQQGGNRNWRFEVGGIFEGKT
PSTDTYFMLANYDYVNALRSRDVDTVDGFVVQPVPGVTASVLASQIDALFANTGTPTRTQ
SEKQFLEAFLRQFADVELIVSLVVGAAFVTILMIVINTMLFAVRERTFEIGVLKTLGFNN
RFIVVLILCETLLIFLVGGAVGIALTKVATQLTGPALGLVLTGPVVIKSLVITVLLGVLT
GCLPAALAMRTTVSNAFRTR