Protein Info for PGA1_c13580 in Phaeobacter inhibens DSM 17395

Annotation: secretion protein, HlyD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 49 to 69 (21 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 126 to 376 (251 residues), 95.3 bits, see alignment E=1.8e-31 PF25917: BSH_RND" amino acids 135 to 280 (146 residues), 30.4 bits, see alignment E=5.6e-11 PF25919: BSH_CusB" amino acids 136 to 279 (144 residues), 35.2 bits, see alignment E=1.8e-12 PF25954: Beta-barrel_RND_2" amino acids 302 to 374 (73 residues), 42.2 bits, see alignment E=1.5e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWA9 at UniProt or InterPro

Protein Sequence (378 amino acids)

>PGA1_c13580 secretion protein, HlyD family (Phaeobacter inhibens DSM 17395)
MAAMGDPLAMNIQTDTHRNLAEALTPLSAVTVSEAQPSLEERQERGPSWTLRIFLLLGLL
AAGGAVLWRSDLPTLAALRNWGEGLLDPASQSVATDVPIAPTPVSDATTRIQPAPVAMPT
AEITGSGYVLVQDYASVFAKYEGTITDLLVALGDPVTRGQPLAAVSDPGAQYALKSALID
QSLAQLRLETKRIEVDQSERDYDRLTSLLAKDAVSERVTQDAATALSLAKTALRQAEQDI
HLANLKVEIAQEHVDELTIRAPVSGTITQLNARIGNSVLARVDTIRDTDYLMVITDTASM
YLDAEVAETNVSRLRVGLTGEAVLDGFPDQPFEVRVVGISPVVSAERGTISLRLELDGPP
DGIRPNMAARIRITLSDT