Protein Info for Psest_1373 in Pseudomonas stutzeri RCH2

Annotation: Serine hydrolase (FSH1).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF12697: Abhydrolase_6" amino acids 90 to 275 (186 residues), 45.9 bits, see alignment E=2.2e-15 PF12146: Hydrolase_4" amino acids 92 to 201 (110 residues), 48.2 bits, see alignment E=1.8e-16 amino acids 229 to 276 (48 residues), 27.6 bits, see alignment 3.6e-10 PF03959: FSH1" amino acids 161 to 271 (111 residues), 26.5 bits, see alignment E=9.9e-10

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 88% identity to psa:PST_2919)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKK5 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Psest_1373 Serine hydrolase (FSH1). (Pseudomonas stutzeri RCH2)
MQRFFLFRSKARRLCLLLIALFAVGLPVGCSVLEQKERELVFRIEPGTASWFSGLPRGIE
ELQLTDSAFGDQQNIHAWWWPAAEADAPALLYLHGVRWNLTGHLFRLEQLRALDFSVLAI
DYRGFGQSLGDLPSERSVYADARIGWERLKELQPDASKRFIYGHSLGGAVAVDLAAELGQ
QAERDDAPAEARALIIESTFTSLADVATVLSDTTLPVRWLLSQKFDSLEKIDRIGMPLLV
VHGTDDRYVPPRFSEQLYEAARQPKQLLLVEGATHNNSLRVALGAYGRALQALLEAGEQQ
LGAAQPAREDIAERG