Protein Info for Psest_1362 in Pseudomonas stutzeri RCH2

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF00005: ABC_tran" amino acids 16 to 139 (124 residues), 91.1 bits, see alignment E=1e-29

Best Hits

Swiss-Prot: 40% identical to SSUB2_PSESM: Aliphatic sulfonates import ATP-binding protein SsuB 2 (ssuB2) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 85% identity to psa:PST_2931)

MetaCyc: 39% identical to taurine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKR7 at UniProt or InterPro

Protein Sequence (214 amino acids)

>Psest_1362 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component (Pseudomonas stutzeri RCH2)
MLELRLDGRHPVLGVIDAQVREGDRICLLGPSGVGKTTLLNGIAGLDPQLQPMIEQRAGL
RVGYLFQEHRLLPWRTVWQNLALVGADAAEIERLLAEVGLSGAADSLPDQLSLGMARRAA
LARCLAIKPDLLLLDEPFASLDAERAAELRGLIARLLDRHPDMAMICVTHDPRDADDLAN
RLWYLSGAPATLRGDEPLGSAVSLSQLSERQRSA