Protein Info for Psest_1361 in Pseudomonas stutzeri RCH2

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 61 to 80 (20 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 169 to 193 (25 residues), see Phobius details amino acids 210 to 235 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 72 to 229 (158 residues), 81 bits, see alignment E=4.9e-27

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 91% identity to psa:PST_2932)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, permease component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGP3 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Psest_1361 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component (Pseudomonas stutzeri RCH2)
MNGSRWACWIALPCAVALWTLIALVVQTPLLPSPATVLDTFWQATRSGELPEHLLVTLRR
VLFAFVLAMALGTLLGVWMGRSRLANAVLDPLLVLFLNLPALVTIILLYVWFGLVEAAAV
LAVVINKVPNVAVTVREGARSIDPKLEQMALVYRFTRWQRIRHVWLPQLFPYLMAATRGG
LALIWKIVLVVELLGRSDGIGFQLHMAFQVFDVASILAYSLAFIAVVQLIELALLQPLER
RASSWREAGVRHA