Protein Info for Psest_1360 in Pseudomonas stutzeri RCH2

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF12974: Phosphonate-bd" amino acids 59 to 258 (200 residues), 27.6 bits, see alignment E=1.9e-10 PF09084: NMT1" amino acids 115 to 261 (147 residues), 31.4 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 79% identity to psa:PST_2933)

Predicted SEED Role

"ABC transporter substrate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJE5 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Psest_1360 ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components (Pseudomonas stutzeri RCH2)
MMLSLPFLTTFILRTRRALLALVLLPLWAQGQELPVLTLSVLQFGTPHWELEHLKRQGLD
RANGFELKVRLVADVPASRLALTSGSVDGAVSDLLWAQARYQAGTAYRYLPFSSQIGEVL
VPEGSAIRTLDDLRGKRIGVAGGPDGLGWLLLQHAAAKSGIDLARQATVQYAAPPLLSQA
LRRDQVDALLTFWHFSARMRGEGGVQVAFGLDDLLRSLELDPHLPVLGYLFPETWAVEHE
ELLQRFATALGQTKHQLATEPAHWQALRPLMRADDGVFAALRDSFLAGIPQPLDEPRIAD
LHRLLTLTGADPAKLMPAASFQSTP