Protein Info for Psest_1359 in Pseudomonas stutzeri RCH2

Annotation: Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF11969: DcpS_C" amino acids 11 to 114 (104 residues), 53.6 bits, see alignment E=3e-18 PF01230: HIT" amino acids 19 to 115 (97 residues), 93.4 bits, see alignment E=1.2e-30

Best Hits

Swiss-Prot: 43% identical to HIT_BACSU: Protein hit (hit) from Bacillus subtilis (strain 168)

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 91% identity to psa:PST_2934)

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.17

Use Curated BLAST to search for 3.6.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIU7 at UniProt or InterPro

Protein Sequence (147 amino acids)

>Psest_1359 Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases (Pseudomonas stutzeri RCH2)
MSLTTSYDPQNIFAQIIRGDAPCYKLYEDDDVLAFLDLFPQSFGHTLVIPKRSAACNILD
VDTEALAKVMAVVQKLTRVIVDELQPDGVQVAQFNGAPAGQTVFHIHVHIVPRYSGEGLG
IHAAGKADPADLEQLQARLQQRIATQG