Protein Info for Psest_1358 in Pseudomonas stutzeri RCH2

Annotation: Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF04389: Peptidase_M28" amino acids 93 to 186 (94 residues), 40.1 bits, see alignment E=7.1e-14 PF01546: Peptidase_M20" amino acids 107 to 406 (300 residues), 115.4 bits, see alignment E=7.1e-37 PF07687: M20_dimer" amino acids 209 to 309 (101 residues), 80.8 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: K01295, glutamate carboxypeptidase [EC: 3.4.17.11] (inferred from 87% identity to psa:PST_2935)

Predicted SEED Role

"Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.17.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKI7 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Psest_1358 Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases (Pseudomonas stutzeri RCH2)
MPIRAIAPIAAAVALCLSSLSAIAAEIKPAELLEQAKAEQSAYIETVKQLVAVDTGTGQA
AGLATVSQMLVERLQALGAEVSTSPATPSAGDNIVGTLKGSGSKDFLLMVHYDTVFAEGT
AAERPFRMDDKRAYGPGVADAKGGVAMILHALELLKAQQFDAYGTITVLFNPDEEMGSAG
SKKIIAELARKHDYVFSYEPPDSDAVTTATNGINAVMLEVKGKSSHAGSAPEDGRNAVME
LAHQLVQLKDLGDPDKGTTVNWTMIAGGEKRNIIPNKATAEADMRYSDISETDRVLTDAQ
KIIGNKLIDDTRVELRVDKGRPPLAKNPASERLAETAQRLYSEIDQRIEPIAMRFGTDAG
YAYVPDSDKPAVLETMGVVGAGLHSEEEYIELSSIAPRLYLTTAMIRALSAEQAP