Protein Info for HP15_1294 in Marinobacter adhaerens HP15

Annotation: deoxycytidine triphosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 4 to 187 (184 residues), 165.4 bits, E=5.3e-53
• PF00692: dUTPase
  • amino acids 81 to 183 (103 residues), 30.1 bits, E=1.8e-11

Best Hits

Swiss-Prot: 99% identical to DCD_MARHV: dCTP deaminase (dcd) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 99% identity to maq:Maqu_0941)

MetaCyc: 70% identical to dCTP deaminase (Rickettsia prowazekii Madrid E)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

See E4PII3 at UniProt or InterPro

Protein Sequence (188 amino acids)

>HP15_1294 deoxycytidine triphosphate deaminase (Marinobacter adhaerens HP15)
MSIKSDKWIRRMSEQHGMIEPFESGQVRETEKGRVISYGTSSYGYDVRCSNEFKIFTNVH
SATVDPKNFDENSFVNYTGDVCIIPPNSFALARTVEYFRIPRSVLTICLGKSTYARCGII
VNVTPLEPEWEGQVTLEFSNTTNLPAKIYANEGVAQMLFFESDEICETSYKDRGGKYLGQ
TGVTLPRT