Protein Info for HP15_1290 in Marinobacter adhaerens HP15

Annotation: electron transport complex, RnfABCDGE type, B subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 15 to 135 (121 residues), 174.5 bits, see alignment E=9.1e-56 PF14697: Fer4_21" amino acids 57 to 111 (55 residues), 72.2 bits, see alignment E=1.2e-23 PF00037: Fer4" amino acids 58 to 79 (22 residues), 30.7 bits, see alignment 7.7e-11 amino acids 88 to 109 (22 residues), 23.6 bits, see alignment 1.4e-08 PF13237: Fer4_10" amino acids 58 to 105 (48 residues), 31.6 bits, see alignment E=5.5e-11 PF12800: Fer4_4" amino acids 62 to 76 (15 residues), 17.9 bits, see alignment (E = 1.3e-06) amino acids 92 to 106 (15 residues), 15.7 bits, see alignment (E = 6.3e-06) PF13187: Fer4_9" amino acids 63 to 109 (47 residues), 27.5 bits, see alignment E=1.1e-09

Best Hits

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIH9 at UniProt or InterPro

Protein Sequence (140 amino acids)

>HP15_1290 electron transport complex, RnfABCDGE type, B subunit (Marinobacter adhaerens HP15)
MRLSRLPALRRIHCRGGPINKCPPGGESTIKALADLLDVEPEPLDAEHGVEQVKRVAVIR
EDECIGCTKCIQACPVDAILGAAKHMHTVIESECTGCDLCVDPCPVDCIDMVTVEPDIRT
WTWTPPKSGLIATDRQGASA