Protein Info for HP15_1289 in Marinobacter adhaerens HP15

Annotation: electron transport complex, RnfABCDGE type, C subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 PF13375: RnfC_N" amino acids 1 to 78 (78 residues), 84 bits, see alignment E=3.7e-27 TIGR01945: electron transport complex, RnfABCDGE type, C subunit" amino acids 1 to 410 (410 residues), 591.9 bits, see alignment E=3.1e-182 PF01512: Complex1_51K" amino acids 102 to 246 (145 residues), 179.2 bits, see alignment E=2.7e-56 PF10531: SLBB" amino acids 259 to 307 (49 residues), 36.2 bits, see alignment 2.4e-12 PF13237: Fer4_10" amino acids 338 to 390 (53 residues), 30.2 bits, see alignment 1.9e-10 PF13183: Fer4_8" amino acids 339 to 393 (55 residues), 31.5 bits, see alignment 1.1e-10 PF13187: Fer4_9" amino acids 340 to 392 (53 residues), 33.9 bits, see alignment 1.4e-11 PF13534: Fer4_17" amino acids 340 to 393 (54 residues), 25.1 bits, see alignment 1.2e-08 PF12838: Fer4_7" amino acids 340 to 392 (53 residues), 38.8 bits, see alignment 5.7e-13 PF12800: Fer4_4" amino acids 340 to 352 (13 residues), 15 bits, see alignment (E = 1.5e-05) amino acids 378 to 390 (13 residues), 13.8 bits, see alignment (E = 3.5e-05)

Best Hits

KEGG orthology group: K03615, electron transport complex protein RnfC (inferred from 81% identity to maq:Maqu_0936)

Predicted SEED Role

"Electron transport complex protein RnfC" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIH8 at UniProt or InterPro

Protein Sequence (580 amino acids)

>HP15_1289 electron transport complex, RnfABCDGE type, C subunit (Marinobacter adhaerens HP15)
MPAQLVLPLQQHIGDPAEAIVEVGERVLKGQKIADVKTGMGVPVHAPTSGVIESIADFPV
PHPSGMADRCITLKPDGEDQCCQRSPVADYRSLERDEVLQIIRDAGISGMGGAGFPTNIK
LRPPRDRKVSTLILNGAECEPYITADDMTMREKADEVVAGLKIMAWILRPERCVIGIEDN
KPEAIAALRKATEGTQTEIAVVPTKYPSGGEKQLIQILTGMEVPSGGIPADIGVMCQNIG
TAVAVANAVLEGTPLISRIVTITGEAVREPGNFETLIGTPIKHLLGQAGVNQDAVSRLVL
GGPMMGYTLTTEAVPVIKTTNCVIAATAAELPAPPPEQPCIRCGQCAEACPMELLPQQLF
WHAKATEFEKAEHLNLFDCIECGACSYVCPSSIPLVQYYRFAKGEIRAQQAEQLKADRAR
ERFEARQARLEREQQEKELRRKERAQAAAEAAAKKQAEAEKAAADGQAVDERAAKSALVE
QALARKKAKAQASQSPAPSAPPTEEKPDIEALEKQLEQARSKLETMQGMLDDAKAQQADN
VEKLERAVAKNHDRVQRAEEALSEAREKLAAGPTESQTTH