Protein Info for Psest_1352 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 201 to 218 (18 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 316 to 339 (24 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 13 to 221 (209 residues), 66.8 bits, see alignment E=1.1e-22

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_2941)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKQ8 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Psest_1352 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MPSPDLTSPATARLQSIDALRGLVILFMLLDHVRETFLLHMQVPDPMDVAVTEPALFFSR
TLAHLCAPVFIFLTGLSAFLYGEKHQDRRAVSSFLLKRGLFLVALEFTLVNFAWTFQFPP
QVIYLQVIWAIGLSMLALSALLWLPRPALIMLGLVIIGGHNLLDSLQFAADSALHVPWAI
LHDRGWIEVAENLRLRTSYPLLPWIGVIALGYAAGPWFGRTADPERRQRYLGGWAQGALL
TFVLLRLINSYGEQPWVVGEDGLRTLMSLFNVTKYPPSLLFLCLTLGCGLLLLRYFERKQ
GRAWLRPLSVFGAAPMFFYLLHLYVLKLLYVAAVAIWGLNHGNHFGFDAVWPLWLCTVAL
AVVLFPAVRWFAELKARRRDITWLKYL