Protein Info for Psest_1345 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized FAD-dependent dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 101 to 121 (21 residues), see Phobius details PF28550: DUF8436" amino acids 1 to 61 (61 residues), 52.4 bits, see alignment E=1.6e-17 PF01266: DAO" amino acids 207 to 281 (75 residues), 29.7 bits, see alignment E=1.5e-10 PF21688: FAD-depend_C" amino acids 285 to 481 (197 residues), 270.4 bits, see alignment E=3.8e-84

Best Hits

KEGG orthology group: K07137, (no description) (inferred from 96% identity to psa:PST_2949)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenase, sll0175 homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGM7 at UniProt or InterPro

Protein Sequence (545 amino acids)

>Psest_1345 Uncharacterized FAD-dependent dehydrogenases (Pseudomonas stutzeri RCH2)
MIRITELSLPLEHPADALREAIVKRLNISDADLLDFTVFKRSYDARKKNSVILFIYIVDV
EVRDEAAVLARFADDNHVRPAPDTRYYPVGQAPANLTERPLVVGFGPCGLFAALLLAQMG
FKPIVLERGKDVRSRTKDTWALWRKKTLTPESNVQFGEGGAGLFSDGKLYSQIKDPKFYA
RKVMHEFVRAGAPEEIMYVSKPHIGTFRLTGVVAAMREEIIALGGEVRFESKVTDLVIDD
GQLEGVVLASGETLRSRHVVLALGHSSRDTFRMLHRQGVYIEAKPFAIGFRIEHPQGMID
QARLGKYAGHPELGAADYKLVYHAKNGRAVYSFCMCPGGTVVAATSEPGRVVTNGMSQYS
RNERNANAGIVVGINPEQDFPGDALAGVELQERLESRAYALGGSDYCAPAQLVGDFIRGV
PSTAFGEVEPSYKPGVCLGDLAPSLPEYAIEAIREALPAFGKQIRGFDRADAVLTGIETR
TSSPVRITRDNETLQSLNLRGLYPAGEGAGYAGGILSAGVDGIKVAEALAKAMMADAGQS
EVQSN