Protein Info for HP15_1280 in Marinobacter adhaerens HP15

Annotation: protein-L-isoaspartate (D-aspartate) O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 12 to 216 (205 residues), 225.8 bits, see alignment E=2.8e-71 PF01135: PCMT" amino acids 17 to 214 (198 residues), 207.9 bits, see alignment E=7.8e-66

Best Hits

Swiss-Prot: 86% identical to PIMT1_MARHV: Protein-L-isoaspartate O-methyltransferase 1 (pcm1) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 86% identity to maq:Maqu_0927)

MetaCyc: 54% identical to protein-L-isoaspartate O-methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-L-isoaspartate(D-aspartate) O-methyltransferase. [EC: 2.1.1.77]

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIG9 at UniProt or InterPro

Protein Sequence (218 amino acids)

>HP15_1280 protein-L-isoaspartate (D-aspartate) O-methyltransferase (Marinobacter adhaerens HP15)
MTAQLEGIGMTSRRTRMRLVQRLREAGIESDRVLEIMGEVPRHIFLDEALSHRAYEDTSL
PIGYGQTLSQPYIVARMTELMLAHGPSRVLELGTGSGYQTSVLSRLFAEIYSVERIKALQ
DRARDRLRQLNARNVFLKHADGGMGWPERGPFDGIIVTAAPIEVPAELLAQLADGGVLIA
PVGEENQVLVQVTRRGDRFDHKELEPVRFVPLLGGVVR