Protein Info for PGA1_c01330 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF04028: DUF374" amino acids 86 to 148 (63 residues), 59.2 bits, see alignment E=1.2e-20

Best Hits

KEGG orthology group: K09778, hypothetical protein (inferred from 55% identity to sil:SPO0729)

Predicted SEED Role

"Protein of unknown function DUF374" in subsystem Lipopolysaccharide-related cluster in Alphaproteobacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWR6 at UniProt or InterPro

Protein Sequence (248 amino acids)

>PGA1_c01330 Uncharacterized protein conserved in bacteria (Phaeobacter inhibens DSM 17395)
MTEQRIQKKEPRVSLRKKIADSPKVNRAVEALLAGYVRFAYRTSRWERRGFEEMDACVAS
GEPVIFVLWHQRLIMAPYLFDTSLGRICALTSAARAGRLAGQILVRLGFETIPMSSHKRH
VALSREVLRRTKEGCSIGIAADGPRGPARVSSGVPITWARMTGCRVFTVAFAERKVIKLP
TWDRQMLPLPFSRGVLLCQEWTEEVPKKPSDEQAEKLRLRLEASLDEITDRADAAVERDG
QSQKNQAS