Protein Info for PGA1_c13250 in Phaeobacter inhibens DSM 17395

Annotation: Zn-dependent hydrolases, including glyoxylases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00753: Lactamase_B" amino acids 97 to 283 (187 residues), 79.7 bits, see alignment E=1.4e-26

Best Hits

KEGG orthology group: None (inferred from 56% identity to sil:SPO2170)

Predicted SEED Role

"Metallo-beta-lactamase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYP6 at UniProt or InterPro

Protein Sequence (328 amino acids)

>PGA1_c13250 Zn-dependent hydrolases, including glyoxylases (Phaeobacter inhibens DSM 17395)
MTLSRRHLLGALAAAPVATLASPSLLRAASHSAAESATPDLPVAYHSFQIGSARVTALLD
GHFLLNTSQINGFDQAEADTVLDGTFYRIKDDQMSLPVNGYLVEQGEAVTLIDAGTADLF
GPILGGLEAALRAAGRTPEEITSVVVTHLHPDHIGGLLKSDGTARFPNAEIVVGQGEYDF
WHDDTVYAGVPQDSRGFFDIARGAVAPYQDRLKMFEGEADVMSGLRSVPLPGHTPGHCGF
LLETGAAPLLIWGDLIHSTALQFARPDWTLAFDMDPEQTVKSRTMMLDRAASEGLLVTGM
HLDFPGLGRVERDGDAYGFDQAPWQFSL