Protein Info for Psest_1340 in Pseudomonas stutzeri RCH2

Annotation: rarD protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 132 to 149 (18 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details TIGR00688: protein RarD" amino acids 8 to 260 (253 residues), 164.7 bits, see alignment E=1.5e-52

Best Hits

Swiss-Prot: 43% identical to RARD_PSEAE: Chloramphenicol-sensitive protein RarD (rarD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 83% identity to psa:PST_2954)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGM2 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Psest_1340 rarD protein (Pseudomonas stutzeri RCH2)
METRNRLAGVAGSLAASTLFATLYYYTSLLEPLSGQQIYGWRILLTAPCLALLLLAIGRW
GEVREILLRVPVEPRLWLALPLSSALVGLQLWLFMWAPINGHGLDVSLGYFLLPLTLVLT
GRLVFGEAISRLQRLACLLAAVGVGNQLLLASSLSWPVLAVALGYPCYFVLRRWIGTASL
GGLWVDLIISLPVAALFAFSDRETLQQLAASPALLLLIIGLGALSALALALMIVASKHLD
LALFGLLSYVEPVLLVAVALLLGESIASDQWLTYVAIWTAIALLIVEGAKALRAARAGVP
QKRSRRVLK