Protein Info for HP15_1276 in Marinobacter adhaerens HP15

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • amino acids 7 to 229 (223 residues), 208.7 bits, E=3.8e-66
• PF01128: IspD
  • amino acids 8 to 231 (224 residues), 201.7 bits, E=1.4e-63
• PF12804: NTP_transf_3
  • amino acids 9 to 131 (123 residues), 29.1 bits, E=1e-10

Best Hits

Swiss-Prot: 53% identical to ISPD_METCA: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 69% identity to maq:Maqu_0923)

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• isoprene biosynthesis I (8/10 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Sequence Analysis Tools

See E4PIG5 at UniProt or InterPro

Protein Sequence (233 amino acids)

>HP15_1276 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Marinobacter adhaerens HP15)
MPSPRLWLIVPAAGIGQRMQAEQPKQYLRIGERFILDITLSRLMDSAPFSGCMVPLHPAD
HWWPDTEASGDSRIQTCTGGSERAGSVLSALHAMAEQVKDDDWVLVHDAARPCLDTRDLS
NLIDRLYSHPVGGLLASPVADTLKKAVTAELPEVIETVDRTGLWRALTPQMFRYRILVDS
LEAALARDLPVTDESSAVEFSGNMPVVVEGRPDNIKITVPADLALAGFILSQF