Protein Info for Psest_1338 in Pseudomonas stutzeri RCH2

Annotation: Predicted aminopeptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF02225: PA" amino acids 156 to 254 (99 residues), 65.4 bits, see alignment E=4.2e-22 PF04389: Peptidase_M28" amino acids 278 to 490 (213 residues), 157.8 bits, see alignment E=2.9e-50

Best Hits

Swiss-Prot: 70% identical to LAP_PSEAE: Aminopeptidase (lap) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 96% identity to psa:PST_2956)

Predicted SEED Role

"Aminopeptidase Y (Arg, Lys, Leu preference) (EC 3.4.11.15)" (EC 3.4.11.15)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIS4 at UniProt or InterPro

Protein Sequence (534 amino acids)

>Psest_1338 Predicted aminopeptidases (Pseudomonas stutzeri RCH2)
MHKKNNAVRVVASLALLTGSAAFAAPQVDTAQFNDFWSPDKPNAALCRSPLLVGTPVGLP
RCMQASNVMKHLEALQDIATMNDGNRASGQPGYQASIDYVRSRLQRAGYRVEVQAFPFLA
FYPVSPGTLSAVAPQPVQYVWEEDFSYADQTDPGNVTAPVVPVDLALGAGNTSTSGCEPE
DFAGFPAGAIALMQRGTCPFGQKATNAAAAGAAGAIIFNQGDTEDRKGLLVATLGEDYSG
GIPVMFSTYDNGVAWSQTAGLQLSMNVDVVREQTETYNLLAETRRGDPSNVIMVGAHLDS
VFEGAGINDNGSGSAALLEMALLMSKARPENKVRFAWWGAEESGLVGSTYYVTQLPDEQK
RRIKAYLNVDMIGSPNYANFIYDGDGSDFGLQGPPGSAAIERLLRTYFQLRNAPSEGTEI
DFRSDYAQFFEDGIAFGGLFTGAEDIKTEEQAQRYGGIAGESFDQCYHTPCDNLGNISTE
ALELHGDALAFATSWLSLSTKMIDDEIAAAAEQSIGTMRIQQVQEKSRWGHWIR