Protein Info for HP15_1272 in Marinobacter adhaerens HP15

Annotation: CTP synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00337: CTP synthase
  • amino acids 2 to 534 (533 residues), 835.1 bits, E=1.1e-255
• PF06418: CTP_synth_N
  • amino acids 3 to 265 (263 residues), 417.6 bits, E=3.1e-129
• PF00117: GATase
  • amino acids 300 to 533 (234 residues), 156.4 bits, E=1.1e-49
• PF07722: Peptidase_C26
  • amino acids 363 to 516 (154 residues), 35.4 bits, E=1.5e-12

Best Hits

Swiss-Prot: 95% identical to PYRG_MARHV: CTP synthase (pyrG) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01937, CTP synthase [EC: 6.3.4.2] (inferred from 95% identity to maq:Maqu_0919)

MetaCyc: 69% identical to CTP synthetase (Escherichia coli K-12 substr. MG1655)
CTP synthase. [EC: 6.3.4.2]

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.2

Sequence Analysis Tools

See E4PIG1 at UniProt or InterPro

Protein Sequence (542 amino acids)

>HP15_1272 CTP synthetase (Marinobacter adhaerens HP15)
MTRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTILKLDPYINVDPGTMSPFQHGEVF
VTEDGAETDLDLGHYERFIRSPMSKRNNFTTGRVYEEVIRKERRGDYLGGTVQVIPHITD
EIKRRVVEGAAGADVALIEIGGTVGDIESLPFLEACRQLKVEVGPQRALFMHLTLVPYIA
TAGEIKTKPTQHSVKEMRSIGLQPDILLCRSEHEVDASSRRKIALFTNVEERAVIPLQDA
KSIYAIPRMLYEHGLDQLVIERFGLDARPADLSEWDNVVESLMNPEQEVTIAMVGKYMEL
LDAYKSLIESLLHAGIKTRTKVNINYIDSEDIERDGTGALANADAILVPGGFGERGVEGK
IRTVQYARENKVPYLGICLGMQVAVIEYARNVAGLTDAHSTEFREHTPEPVVGLITEWLD
STGEREERTEESDLGGTMRLGAQDCVLTEGSTIANCYGKKTIRERHRHRYEVNNHFLPKL
EEAGLQISGRSTDGRLVEVVEAPDHPWFVACQFHPEFTSTPRDGHPLFKGFVEAALTCKK
GS