Protein Info for HP15_1271 in Marinobacter adhaerens HP15

Annotation: cell cycle protein MesJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF01171: ATP_bind_3" amino acids 30 to 208 (179 residues), 184 bits, see alignment E=3.6e-58 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 30 to 212 (183 residues), 175 bits, see alignment E=1.6e-55 PF09179: TilS" amino acids 257 to 323 (67 residues), 54.8 bits, see alignment E=1.4e-18 PF11734: TilS_C" amino acids 368 to 443 (76 residues), 73.3 bits, see alignment E=1.2e-24 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 368 to 412 (45 residues), 45 bits, see alignment 5.8e-16

Best Hits

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 54% identity to maq:Maqu_0918)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIG0 at UniProt or InterPro

Protein Sequence (449 amino acids)

>HP15_1271 cell cycle protein MesJ (Marinobacter adhaerens HP15)
MTPGAEPGSGFRWPEALCAPVRELPDHTRLWVALSGGLDSTLLLHLAAHCHGCSGAVRAI
HINHQLQPNASDTESFCRGECERLGVPLVVERVTVDGGRSSGAGIEEAARKARYAALEAL
VGKGDLVLMAHHGDDQAETVLFRMLRGSGVAGLAGMPASRELGTATLVRPLLGFERAELE
RWARVAGLSWVDDPSNTDQRFDRNFLRHTVLPLLRDRWPGLNRRLRHTAESCGESEALNR
KLAALQWQAIGGDRDRLPVDGLKTLPLAEQKNLVRWWARERGFHAPTPGDWQQVIRDLLF
AAEDREPEFRSDGFSLRRFQGDLCLVPDRGPLPDAPVDLEPGEGVAWGEWSLRLESVVTP
EQSLPPIRIFTRQGGERVRFRPDGPSRSLKKWLQEVGVPPWERTRLPLVFAGSGDAAELI
AIGDLWCSEQYSGGAHAAGWRLVVERECD