Protein Info for PGA1_c13160 in Phaeobacter inhibens DSM 17395

Annotation: mannitol 2-dehydrogenase MtlK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 PF01232: Mannitol_dh" amino acids 28 to 191 (164 residues), 135 bits, see alignment E=2.6e-43 PF08125: Mannitol_dh_C" amino acids 222 to 457 (236 residues), 222.2 bits, see alignment E=7.6e-70

Best Hits

Swiss-Prot: 52% identical to MTLK_RHOSH: Mannitol 2-dehydrogenase (mtlK) from Rhodobacter sphaeroides

KEGG orthology group: K00045, mannitol 2-dehydrogenase [EC: 1.1.1.67] (inferred from 64% identity to sit:TM1040_0426)

Predicted SEED Role

"Multiple polyol-specific dehydrogenase (EC 1.1.1.-)" in subsystem Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.- or 1.1.1.67

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EW69 at UniProt or InterPro

Protein Sequence (488 amino acids)

>PGA1_c13160 mannitol 2-dehydrogenase MtlK (Phaeobacter inhibens DSM 17395)
MKLSNDTLSQLPQTIGRPSYDRAEISPGIVHIGLGNFHRAHQAWYLHALMQSGLAMDWGI
IGAGVRAADAGMRDRLLAQDCLTTLIELDPTGRSAEVIGPLIDFLPVEADNASLIRCMAG
SPIRIVSLTVTEGGYYQDAQHKGLDLNHEDIRHDIARPDRPRTVFGAIVEALRLRRGRGL
PAFTVQSCDNLQGNGQITRTAVVTLAQQTDPELAAWIDQTGAFPNSMVDCIVPATGPAEI
ALARGYGIEDTAPVTHENYRHWVIEDEFCAGRPPWDLAGAIFTDDVHGYESMKIRVLNAG
HQVLANAGELLSIATIADCMKDPLLAAFFRTVQTAEILPHVIAVPEMAPKDYLTLIEARF
SNPEIRDTTRRVAYDGSSRHPGFVMPILRDAVRSKGAIDGLCLVEALWAQMCTGLREDAS
EIAPNDPDWETRKSAAERAQKNPEVWLQQSQIYGDLSEQPGVVERFSYWLSMIRSQGCRA
ALSEYLGH