Protein Info for HP15_1268 in Marinobacter adhaerens HP15

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00578: AhpC-TSA" amino acids 30 to 136 (107 residues), 50.8 bits, see alignment E=2.5e-17 PF08534: Redoxin" amino acids 32 to 151 (120 residues), 32.6 bits, see alignment E=9.8e-12 PF00085: Thioredoxin" amino acids 49 to 88 (40 residues), 23.6 bits, see alignment E=6.5e-09

Best Hits

KEGG orthology group: None (inferred from 79% identity to maq:Maqu_0915)

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIF7 at UniProt or InterPro

Protein Sequence (155 amino acids)

>HP15_1268 thioredoxin (Marinobacter adhaerens HP15)
MQYPDSVRRRSGLHVLAVALLILAMSGCQKIELERAEGTKLNWDTLRGQWVLVNYWAEWC
KPCLEEIPELNELDKAPDITVLAVNFDGVRGDALVELGERMGIEFTMLADDPGPGFGWKL
PVALPATFLVNPGGDLVETRFGPQTEEELRAVIGG