Protein Info for Psest_1322 in Pseudomonas stutzeri RCH2

Annotation: 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF03446: NAD_binding_2" amino acids 7 to 166 (160 residues), 164.8 bits, see alignment E=2.6e-52 PF03807: F420_oxidored" amino acids 7 to 70 (64 residues), 29.9 bits, see alignment E=1e-10 PF14833: NAD_binding_11" amino acids 169 to 290 (122 residues), 86.5 bits, see alignment E=2.6e-28

Best Hits

Swiss-Prot: 38% identical to Y229_SYNY3: Uncharacterized oxidoreductase slr0229 (slr0229) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 94% identity to psa:PST_2974)

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.31, 1.1.1.60

Use Curated BLAST to search for 1.1.1.31 or 1.1.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKF3 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Psest_1322 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases (Pseudomonas stutzeri RCH2)
MSDLPTLAFAGIGLMGLPMCRRLLAAGYRLVVWNRSPEKCEPLVALGARAVATPAELCAE
ADIVLLCLADTAAVREVLFGKGGIAEGGKAGKLLVDHSSLEPAATRDMAAELEFRSGMRW
VDAPVSGGTPGAEAGSLVIMAGGRVEDVERVRPVLMNLGQRLTHMGEVGAGQVTKVCNQM
IVACNALVIAEVVALAERAGVDASLLAPALAGGFADSRPLQILAPQMAASEFEPVKWHVR
TLLKDLDTAVKLSREQGSATPLSGLAAQLMRLHGSQGNLERDPATLVQMYWEDEQ