Protein Info for Psest_1318 in Pseudomonas stutzeri RCH2

Annotation: ABC-type phosphate/phosphonate transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 138 to 165 (28 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 119 to 272 (154 residues), 51.4 bits, see alignment E=5.7e-18

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 92% identity to psa:PST_2979)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE2 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIQ0 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Psest_1318 ABC-type phosphate/phosphonate transport system, permease component (Pseudomonas stutzeri RCH2)
MLNPALVRQDPATASRLMLTLLVVALLWPGLKLSELDLGVLFDGSNADTMGTFVSAFWPP
EHSGEFLELLWQATLETLAIATAGMALALGVALPCALLATRAMSLSALSRGGRPAWWAQA
LRWPVRGLLIVLRSVPEIVWALLFVRAVGLGPTAGVLAIAITYAGMLGKVYAEIFESVDP
LPARALLGAGASRLQAFLYGVLPQATGEMLSYSVYRWECAIRASVVMGFVGAGGLGQQMD
LSMRMFAGGEVASMLLTFLMLVLLADLLSRLLRWRFA