Protein Info for PGA1_c12970 in Phaeobacter inhibens DSM 17395

Annotation: TRAP transporter, subunit DctQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details PF04290: DctQ" amino acids 39 to 172 (134 residues), 75.4 bits, see alignment E=2.1e-25

Best Hits

KEGG orthology group: None (inferred from 80% identity to sil:SPOA0239)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, small permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZV2 at UniProt or InterPro

Protein Sequence (216 amino acids)

>PGA1_c12970 TRAP transporter, subunit DctQ (Phaeobacter inhibens DSM 17395)
MAGSAAVLEDGSLISRWDRQLLRLERVMALISGLAVFSLMVLAVVSVGGRNAFNAPLPGY
VDWIEQVMPLIAFMGISFVQRDGSHIRMDLVISALRGRALWLFELISVLLILALMLALLW
GSWSHFLRSFDFAAPLWSRDSSIDIGLPIWPAKLLAPVAFAVLCLRLLLQVWGYGRALVL
GLARPAAVPLVQSAAEQAAAEAEHLGGVSTSASDRD