Protein Info for HP15_1251 in Marinobacter adhaerens HP15

Updated annotation (from data): large component of pyruvate transporter (actP-like)
Rationale: Important for pyruvate utilization. Distantly related to E. coli actP.
Original annotation: sodium: solute symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 392 to 418 (27 residues), see Phobius details amino acids 439 to 457 (19 residues), see Phobius details amino acids 463 to 485 (23 residues), see Phobius details amino acids 496 to 514 (19 residues), see Phobius details amino acids 534 to 558 (25 residues), see Phobius details TIGR03648: probable sodium:solute symporter, VC_2705 subfamily" amino acids 8 to 579 (572 residues), 833.3 bits, see alignment E=4e-255 PF00474: SSF" amino acids 33 to 294 (262 residues), 127.9 bits, see alignment E=2.4e-41 amino acids 389 to 504 (116 residues), 57.1 bits, see alignment E=7.6e-20

Best Hits

KEGG orthology group: K14393, cation/acetate symporter (inferred from 92% identity to maq:Maqu_0900)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PHQ0 at UniProt or InterPro

Protein Sequence (588 amino acids)

>HP15_1251 large component of pyruvate transporter (actP-like) (Marinobacter adhaerens HP15)
MSQFAINIIFVGGSFLLYIAIAIWAKAGSTSDFYVAGGGVHPITNGAAIGADWMSAASFI
SMAGLIAAGGYANSTFLMGWTGGYVLLAMLLAPYLRKFGKFTVPEFIGDRFYSKNARLVA
VICLIVASVTYVIGQMAGAGVAFSRFLEVDSTVGLMIAAVVVFVYAVMGGMKGITYTQVA
QYCVLIVAYTIPAVFISLQLTGNPIPGLGLFSTHVDSGMPILSKLNQVITDLGFNEYTAD
IDNKLNMVLFTLSLMIGTAGLPHVIIRFFTVPKVADARWSAGWALVFIALLYLTAPAVAS
MARLNLMTTIYPDGTSAEPIQYDERPNWIKEWEITGLIQFTDKNEDGRIQLYNDSEAFAP
TAEARGWNGNELVVNRDILVLANPEIANLPGWVIGLIAAGGLAAALSTAAGLLLAISSAV
SHDLIKGSINPAISEKGELLAARISMAVAIVVATYLGANPPGFAAQVVALAFGIAAASLF
PALMMGIFSKRVNNTGAIAGMLSGLTFTLVYIFVYKGWLFIPGTNNLPDTPDNWVLGISP
LSIGAIGAIVNFAVAFIVSNATEEPPVEIQELVESVRYPRGAGQAQDH