Protein Info for PGA1_c01300 in Phaeobacter inhibens DSM 17395

Annotation: DNA topoisomerase 4 subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 782 TIGR01062: DNA topoisomerase IV, A subunit" amino acids 22 to 781 (760 residues), 820.2 bits, see alignment E=7e-251 PF00521: DNA_topoisoIV" amino acids 42 to 502 (461 residues), 478.1 bits, see alignment E=2.7e-147 PF03989: DNA_gyraseA_C" amino acids 583 to 631 (49 residues), 12.3 bits, see alignment 9.4e-06 amino acids 636 to 671 (36 residues), 21.3 bits, see alignment (E = 1.4e-08) amino acids 681 to 714 (34 residues), 15.9 bits, see alignment (E = 7.2e-07)

Best Hits

KEGG orthology group: K02621, topoisomerase IV subunit A [EC: 5.99.1.-] (inferred from 89% identity to sit:TM1040_2432)

Predicted SEED Role

"Topoisomerase IV subunit A (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DL76 at UniProt or InterPro

Protein Sequence (782 amino acids)

>PGA1_c01300 DNA topoisomerase 4 subunit A (Phaeobacter inhibens DSM 17395)
MTDLVDDQDTPDSPASGEVLEPLRRAIGERYLTYALSTIMHRALPDARDGLKPVHRRILY
AMSRLRLTSTGGFLKSAKISGDTMGDFHPHGDAAIYDAMARLAQDFNVRYPLVDGQGNFG
NIDGDNPAASRYTEARMTFVAEAMLEGLSENAVDFRDNYDGRLTEPAVLPATFPNILANG
AAGIAVGMATNIPPHNIGELIDACLHLIKTPDARDDTLLNYVPGPDFPTGGIIVEPKENI
AKAYNTGRGSFRLRCTHEVEDLGRGQWQIVITEIPYQVQKSKLIEKIAELIQTKKIPILA
DVRDESAEDIRIVLEPKSKNVDPEVLMNMMFRNSDLEIRFSLNMNVLIDGVTPKVCSMKE
VLRAFLDHRRDVLQRRSQHRMDKIDHRLEVLEGFIIAFLNLDRVIDIIRYDDDPKAALMR
ENWSLDHPRAYTEADYVSPAIGAGELTEVQAEAILNMRLRSLRRLEEIELVRERDALREE
RAGLVELLASEDLQWSRIAEQLKDTKKQFGKTYEGGPRRTRFAEAGEVEEVPLEAMIDRE
PITVVCSQMGWIRAMTGHIDLGRELKFKDGDGPRFIFHAETTDRLLVFASNGRFYTISAS
NLPGGRGMGEPLRLMVDLPNEVEIVDILIHNPEGRLLVASDAGNGFICAEKDIVAQTRSG
KQVLNVKDDDRAKICIRVTGDHVAVVSENGKFLVFAVEEMPELTRGKGVRLQKYNMARGK
QGSLELDGGLSDVTTFNWDDGISWEMGGGKTRHETDLGQWLGKRAGIGKRPPYGFPRNYK
FK