Protein Info for Psest_1311 in Pseudomonas stutzeri RCH2

Annotation: Branched-chain amino acid ABC-type transport system, permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 241 to 269 (29 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 11 to 291 (281 residues), 170.4 bits, see alignment E=2.3e-54

Best Hits

Swiss-Prot: 87% identical to BRAD_PSEAE: High-affinity branched-chain amino acid transport system permease protein BraD (braD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 98% identity to psa:PST_2983)

MetaCyc: 68% identical to branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKL8 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Psest_1311 Branched-chain amino acid ABC-type transport system, permease components (Pseudomonas stutzeri RCH2)
MPELYHYLQQLINGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVTFIAIVGL
SMMGLDALPILMIGAFVAAMIVTSAYGYSIERVAYRPLRGSNRLIPLISAIGMSIFLQNV
VLLAQDSKDKAIPNLMPGNLVIGESAMNGVVISYMQILIFVVTFVAMYGLTLFISRSRLG
RACRACAEDLKMANLLGINTNSIIALTFVIGAALAAVAAVLISMQYGVINPHIGFLAGIK
AFTAAVLGGIGSIPGAMLGGLVLGVAEAFGADIFGDQYKDVVAFSLLILVLLFRPTGILG
RPEVEKV