Protein Info for PGA1_c12880 in Phaeobacter inhibens DSM 17395

Annotation: putative ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 199 to 224 (26 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 272 (173 residues), 92.9 bits, see alignment E=1e-30

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 85% identity to sit:TM1040_1494)

Predicted SEED Role

"Pyrimidine ABC transporter, transmembrane component 1" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYL4 at UniProt or InterPro

Protein Sequence (281 amino acids)

>PGA1_c12880 putative ABC transporter permease protein (Phaeobacter inhibens DSM 17395)
MMMVSMALLVWCGGWWLNGRLANSPASNTSAVKLLVPAIFGVTLLIVWELLVRGLEVSLV
ILPAPSVIAARFATSLPILWQDFQQTILKGALSGYIIGCGAALLMAIAVDRSDFLRRGLL
PVGNFVAALPIVGTAPILVMWFGFDWQSKAAVVVVMVFFPVLVNTVAGLRETSAMQRDLM
QTYAASYWQSFFKLRLPAALPFVFNGLKISTTLALVGAIVAEFFGSPTVGMGFRISTSVG
QLALDMVWAEILVAALAGSAFYGMMALIEKTLTFWHPSQRG