Protein Info for Psest_1304 in Pseudomonas stutzeri RCH2

Annotation: Nucleotidyltransferase/DNA polymerase involved in DNA repair

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF00817: IMS" amino acids 12 to 159 (148 residues), 181 bits, see alignment E=2.7e-57 PF11798: IMS_HHH" amino acids 173 to 202 (30 residues), 26.8 bits, see alignment (E = 8.6e-10) PF21999: IMS_HHH_1" amino acids 185 to 235 (51 residues), 37.8 bits, see alignment 4.5e-13 PF11799: IMS_C" amino acids 245 to 351 (107 residues), 42 bits, see alignment E=2.3e-14

Best Hits

Swiss-Prot: 78% identical to DPO4_PSEE4: DNA polymerase IV (dinB) from Pseudomonas entomophila (strain L48)

KEGG orthology group: K02346, DNA polymerase IV [EC: 2.7.7.7] (inferred from 93% identity to psa:PST_2990)

MetaCyc: 51% identical to DNA polymerase IV (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]; 2.7.7.7 [EC: 2.7.7.7]

Predicted SEED Role

"DNA polymerase IV (EC 2.7.7.7)" in subsystem DNA repair, bacterial (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ90 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Psest_1304 Nucleotidyltransferase/DNA polymerase involved in DNA repair (Pseudomonas stutzeri RCH2)
MSQPNLRKIIHIDCDCFYAAIEMRDDPSLARRPIAVGGAADRRGVIATCNYEARAYGVRS
AMASGHALKLCPDLLILRPRMEAYREASREIQNIFRTYTELIEPLSLDEAYLDVTACEHF
SGSATRIAEDIRRRVWQQLRITVSAGVAPNKFLAKIASEWNKPDGLFVITPAQVDEFVQE
LEVKRLHGVGRVTAEKLARLGIHTCNDLREWGRLALVREFGAFGERLWGLARGIDERPVQ
VENRRQSVSVEQTYDRDLPDLAACLERLPELLQQLATRMARLDGSYRPGKPFVKLKFHDF
TQTTLEQAGAGLELDDYSDLLAIAFSRGARPVRLIGVGVRLIDLRGGFEQLRLF