Protein Info for Psest_1296 in Pseudomonas stutzeri RCH2

Annotation: excinuclease ABC, B subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 TIGR00631: excinuclease ABC subunit B" amino acids 3 to 665 (663 residues), 1093.9 bits, see alignment E=0 PF04851: ResIII" amino acids 11 to 86 (76 residues), 41.3 bits, see alignment E=5.6e-14 PF17757: UvrB_inter" amino acids 158 to 248 (91 residues), 113.9 bits, see alignment E=1.1e-36 PF27431: UvrB_3rd" amino acids 253 to 314 (62 residues), 104 bits, see alignment E=1.1e-33 PF00271: Helicase_C" amino acids 435 to 543 (109 residues), 70.4 bits, see alignment E=5.2e-23 PF12344: UvrB" amino acids 550 to 592 (43 residues), 73 bits, see alignment 4.8e-24 PF02151: UVR" amino acids 633 to 666 (34 residues), 27.3 bits, see alignment (E = 8.3e-10)

Best Hits

Swiss-Prot: 91% identical to UVRB_PSEF5: UvrABC system protein B (uvrB) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 98% identity to psa:PST_2997)

MetaCyc: 73% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGI0 at UniProt or InterPro

Protein Sequence (671 amino acids)

>Psest_1296 excinuclease ABC, B subunit (Pseudomonas stutzeri RCH2)
MSKFELVTRFKPAGDQPEAIRQMIEGIEAGLSHQTLLGVTGSGKTFSIANVIAHVQRPTL
VLAPNKTLAAQLYGEFKAFFPNNAVEYFVSYYDYYQPEAYVPSSDTFIEKDASINDHIEQ
MRLSATKALLERPDAIIVTTVSCIYGLGDPQSYLKMVLHVDRGDRLDQRELLRRLTGLQY
TRNDMDFARATFRVRGDVIDIFPAESDLEAVRIELFDDEVESLSAFDPLTGEVIRKLPRF
TFYPKSHYVTPRETLLDAIEKIKDELRERLDYLRSQNKLVEAQRLEQRTRFDLEMIMELG
YCNGIENYSRYLSGRDAGEPPPTLFDYLPADALLVIDESHVSVPQVGAMYKGDRSRKETL
VEYGFRLPSALDNRPMRFDEWEAICPQTIFVSATPGPYEAEHAGRVVEQVVRPTGLVDPQ
IEVRPALTQVDDLLSEIRKCVVKEERVLVTTLTKRMAEDLTDYLSDHDVRVRYLHSDIDT
VERVEIIRDLRLGTFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTIGRA
ARNLNGRAILYADNVTGSMQRAMDETERRRNKQIAFNEANGIVPKGVTKDVRDILEGATV
PGSRSKKRRGEAKAAEESARYENELRSPSEITKRIRQLEEKMLSLARDLEFEAAAEARDE
IHKLRERLLQV