Protein Info for Psest_1287 in Pseudomonas stutzeri RCH2

Annotation: GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit/GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain" amino acids 11 to 206 (196 residues), 257.6 bits, see alignment E=5.2e-81 PF00117: GATase" amino acids 12 to 201 (190 residues), 138.7 bits, see alignment E=5.7e-44 PF07722: Peptidase_C26" amino acids 75 to 184 (110 residues), 25.4 bits, see alignment E=3.4e-09 TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain" amino acids 213 to 526 (314 residues), 493.5 bits, see alignment E=2.6e-152 PF02540: NAD_synthase" amino acids 216 to 291 (76 residues), 30.2 bits, see alignment E=7.5e-11 PF00958: GMP_synt_C" amino acids 434 to 525 (92 residues), 139.1 bits, see alignment E=1.2e-44

Best Hits

Swiss-Prot: 92% identical to GUAA_PSEMY: GMP synthase [glutamine-hydrolyzing] (guaA) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 98% identity to psa:PST_3007)

MetaCyc: 72% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKC3 at UniProt or InterPro

Protein Sequence (526 amino acids)

>Psest_1287 GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit/GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit (Pseudomonas stutzeri RCH2)
MAHPDIHAHRILILDFGSQYTQLIARRVREIGVYCELHPWDMSEDDIRAFAPRGIILAGG
PESVHEEGSPRAPQAVFDLGVPLFGICYGMQTMSEQLGGKVQGSDVREFGYARVDLVGKS
KLFDGIEDHMDDDGVFGLDVWMSHGDKVTEIPAGFHILASTPSCPIAAMGDDVRGYYGVQ
FHPEVTHTRQGGRILSRFILDICGCEALWTPSNIVEDAIAQVRAQVGDANVLLGLSGGVD
SSVVAALLHRAIGDQLTCVFVDNGLLRLHEGDQVMAMFAENMGVKVIRADAEAQFLGNLE
GEADPEKKRKIIGRTFIDVFDAEASKLDNIQFLAQGTIYPDVIESAGAKSGKAHVIKSHH
NVGGLPEEMNLKLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKE
YADLLRRADHIFIEELRNFDWYHKTSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETID
FMTARWAHLPYELLEKVSNRIINEIEGISRVTYDVSSKPPATIEWE